TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8L725|MTPC1_ARATH Metal tolerance protein C1 OS=Arabidopsis thaliana GN=MTPC1 PE=2 SV=1
MGIIRFQILNPTRICRSTIYYMSCRYLPSSSSSSSPLRVSSSSSQKPSFDFSRRWHFGHPDHHQQYQKPGEEGEKIFRLG
LTADIGLSVAKALTGYLCGSTAIIADAAHSVSDVVLSGVALVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSG
IAWHALDLLSIALSAAPEVIHSGHHHGIDMNHPILALTVTIASISIKEGLYWITKRAGEKQGSGLMMANAWHHRSDAISS
LVALVGVGGSILGVNFLDPLAGLVVSTMIVNAGLKTGHQSILELVDAAIPAQQLEPIRQTILQVEGVKGCHRLRGRRAGS
SLYLDVHIVVDPFSSVSVAHEVGEYVRRQINLNHPEVSEVFIHIDPAFLQFSCSTKDHDSITKESNICQEIKHVEATVSD
IFSSQLSEKLTIKRITPHLLHSKILLQIVVAMPSTMSIQDVMIAAEHAEKEILKAAPNVARVSIQLSLNSE