TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8L7E9|MCAC1_ARATH Protein MID1-COMPLEMENTING ACTIVITY 1 OS=Arabidopsis thaliana GN=MCA1 PE=2 SV=1
MSHSWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKISEMKKYPETREPLEGLED
ALRRSYLLVNSCRDRSYLYLLAMGWNIVYQFRKHQDEIDRFLKIIPLITLVDNARIRERFEYIDRDQREYTLDEEDRHVQ
DVILKQESTREAASVLKKTLSCSYPNLRFCEALKTENEKLQIELQRSQEHYDVAQCEVIQRLIGVTQAAAAVEPDSEKEL
TKKASKKSERSSSMKTEYSYDEDSPKKSSTRAASRSTSNVSSGHDLLSRRASQAQHHEEWHTDLLACCSEPSLCFKTFFF
PCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTCCVRRKLRKTLNITGGFIDDFLSHVMCCCCALVQELREVEI
RGAYGTEKTKISPPSSQFMEH