TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Q041|Q8Q041_METMA Glycine betaine transporter, ATP-binding protein OS=Methanosarcina mazei GN=MM_0297 PE=3 SV=1
MSFTKLFDRIDSVRLENITKKYGEHFAVKNLNLEIKGGELLILIGRSGSGKTTAIRTINRLIEPDSGAVFINGIDTREFD
PVRLRRNIGYVIQNIGLLPHLRISENIGLLLKLEGWKEERIRKRVSELLSLVSLPPESFMDRYPHELSGGQQQRVGLARA
MAMDPPLFLMDEPFGALDPLLRTQLQDEFFRIKKELGRTIVFVTHDINEAFRLGDRIAIMNNTELVQVGTPEELIFSPAS
DLVAEIADSKRKYRHIDALKAGDMMQPINRELTLDPEMPAETALDLIVRNGLELAFVTSPEISGRIGLNDVLKARSEGRE
LKEAIKPLPLFSSGAPLLEALTELKSRGESMGLVVADNEPVGVLFSDRVLQNLI