TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Q042|Q8Q042_METMA Glycine betaine transport system, permease protein OS=Methanosarcina mazei GN=MM_0296 PE=3 SV=1
MIIEGLNDFTAEIIRVWNTQMLSLRTVEHLYMFFFALFFSILIGVVTGVLTYRNQKLAGPVLNSLNVVETVPDVALLVLL
LPIFGIGAAPTIVASILYSILPIARDTYTGLSNVPREYIEIAEALGLTPREVLFKVRFPLSLPLIAGGVRIAVVFTMGVV
TLGGLIAAGGLGAALQNGIQLYDMGTILVTGAWVGLLAVLLDGIAGIIEKILKARYGTWS