TCDB is operated by the Saier Lab Bioinformatics Group
>Q8RKC0|Q8RKC0_ENTFA Membrane subunit - Enterococcus faecalis subsp. liquefaciens.
MNLYVNMRSAWKAIKNNRKRSVLTMIGIIIGISSVITILAIGRGFERDTVKNLTKSDSKNVEVQLNFTPSDTSLYDTNTK
FFQDVDLSTVRNVEGVKKADYSKIDEEQIYKDLSIRGNKKNKQIKLIDSEGKKVSIGRNLTGQDSELLNKVATIDSVTAK
ELFNTPERALGKGIEIEQELFRVVGVFPGEEPDNLFSLSNTNIEIPKDTYHYYFKSEKNTSSLTLTLEEGVKPDKVTSKV
IKQLKEKGSLRHLGEYEVLDTAMLTKGIGQILSTITYFITAVAGISLFIAGVGVMNMMYISVSERTKEIGIRRALGATRK
SIMLQFLLEGLILTISGGIIGYLLGMVFAYGIGSLIKVHVSVDLFTIILAVGVSSVIGLVFSVMPASEAAKKDLIDILR