TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8TAF8|TMHS_HUMAN Tetraspan membrane protein of hair cell stereocilia OS=Homo sapiens GN=LHFPL5 PE=1 SV=1
MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVNTPQAGYFGLFSYCVGNVLSSELICK
GGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRM
CGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGTEEV