TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8TL61|KUP_METAC Probable potassium transport system protein kup OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=kup PE=3 SV=1
MFSKSDFRGIINSMGLVFGDIGTSPIYTLTVIFLLTRPTEVHVIGVLSLIIWTLITLVTVEYAWLAMSLGKKGEGGTIVL
KELLVPLIKSGRNAAFITLLAYIGVSFLVGDGVITPAISILSAVEGLRIIPDFQDIGQGAIMFIAGIIAVALFSVQSKGT
EEITWVFGPVMVLWFASLAFSGIASIFYTPGVLRAINPYYAISFLLHNGFTGFFVLSEVILCATGGEALYADMGHLGREP
ILKAWRLVFSALVLNYLGQGAFIIRNPESKNILFEMINQQAEVIYIPFLILSITATIIASQAMISGMFSIVYQGITTRII
PMLKIDYTSGKLRSQIYIGAVNWLLLISVLFMIFEFRDSHRLAAAYGLAVTGTMSITGLMMTLIFYLKGRMFRSFVSLFV
TVIDVVFLLSNTYKIPHGGYWSIVIAAIAFSLIIIYTSGQKKLYELMNPMKIGDFLEKYKQVYASENKISGTALFFARDI
NYVPRYISNVMFENNIIYEDNIFISIIKCESPFGVKSSFAKDLAKGLRVFEINVGYMEVIDVVQILKDKGIQEKTIFYGI
EDILTSNLIWKVFSVIKKLSPSFVQFYKLPSDKLHGVLTRFEM