TCDB is operated by the Saier Lab Bioinformatics Group
>Q8TM31|Q8TM31_METAC ABC transporter, permease protein - Methanosarcina acetivorans.
MLEKAKVSFFLASRSITRGNKGITIFTVFVLTLIFIQLVLFSSILAGVTLKFNELMVDYQTGNVVIEPKEEEHYIEDASA
LQKKIESLPQVVGTSARLKTTGTFRYKEKEIGGTVYGIDPADEAFVTGLEGAVISGEFLSRPDRGEIILGREVSGGYGAL
MESRSLGGVEVGDTIELTISGKTKEFRVKGIYSTLFFMADAGAYISRADMEEMLGVENEDYAQEIAVKTTPGTDEYETRT
ALLSLGIKENIRTWHEFAGILRLIENTLGLVRNIMNAIGLLIAFVIIFVVIYVNIVNKKRQIGVQKAIGIEQNVIVASFV
LQAMLYAGTGIILGYAFMRFGLVPYTVSHPLQVPLGAMSLKLDDAEAIDRAILLFLASIIGSVIPAYKLAQKDLLDLIWG
K