TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8TSY2|Q8TSY2_METAC Na+-transporting NADH:ubiquinone oxidoreductase, subunit 3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=nqr3 PE=4 SV=1
MSDSKEITKVIVTMVVISAVAAALLALTYTPTQAQLKLLQAEQQKEAMKEILPQAADFEPVTGSEVDDDGNPVVLYYKGV
DSSGNVVGYVVERNQVGAQGMIQLLAGISSDFSTITGFQVMKHSETPGLGALITTPEFQGQFVDLPVADTSLTKNGGQVD
AISGATISSQAVVDALHSAVDYVSAQEG