TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8TTG6|Q8TTG6_METAC Uncharacterized protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0471 PE=4 SV=1
MMASPPSTRYIGNESVWIFPTAPPKESMSSIEKKKYGLIEIPVSDFEKHAYDLGLPTAIVSEHIKLGEPLYVITNPDIKI
ESCKFEGKKTITKDEEDTSYSMDREF