TCDB is operated by the Saier Lab Bioinformatics Group
>Q8U4K4|Q8U4K4_PYRFU Sulfate/thiosulfate transport protein homolog cyst - Pyrococcus furiosus.
MDRRDYLAYAFAGLGAFLVAFIGLPLFMIFIKQAYDLEALQRTLVDPLVIESIRNSLFTATVSTLLGILFGVPLGYVLAR
KEFKGKNFVQALIDTPIVIPHSVVGIMLLVTFSDAILDNYKGIVAVMLFVSSPFIVNSARDGFLSVDEKLEYVARTLGAS
GLRTFFSVTLPNAIHSIASGAIMAWARAISEVGAILIVAYYPKTAQVLIMEYFNNYGLRASRPIAVILVTISLAVFIFLR
WLVGRGRNA