TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8UWY2|Q8UWY2_9HEPC P7/NS2 protein (Fragment) OS=Hepatitis C virus subtype 1b GN=e2(p7)-NS2 PE=2 SV=1
AAWYIKGRLVPGAAYAVYSVWPLLLLLLALPPRAYAMDREMAASCGGAVFVGLVLLTLSPHYKAFLARLI