TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8WVE7|T170A_HUMAN Transmembrane protein 170A OS=Homo sapiens GN=TMEM170A PE=2 SV=1
MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALVSSLFFHVPAGLLALFTLRHHKYGR
FMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRILATL