TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8WY22|BRI3B_HUMAN BRI3-binding protein OS=Homo sapiens GN=BRI3BP PE=1 SV=1
MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQKFLARLTERF
VLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWI
VRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNR
VLESLDRSKDK