TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8X5H7|Q8X5H7_ECO57 Putative structural protein (Partial) OS=Escherichia coli O157:H7 GN=Z0469 PE=4 SV=2
MHSWKKKLIVSQLALACTLAITSQANAATNDISGQTYNTFHHYNDATYADDVYYDGYVGWNNYAADSYYNGDIYPVINNA
TVNGVISTYYLDDGISTNTNANSLTIKNSTIHGMITSECMTTDCADDRATGYVYDRLTLSVDNSTIDDNYEHYTYNGTYN
NAADTHVVDVYDMGTAITLDQEVDLSITNNSHVAGITLTQGYEWEDIDDNTVSTGVNSSEVFNNTITVKDSTVTSGSWTD
EGTTGWFGHTGNASNYSNTLTADDVAIAAIANPYADNAMQTTVTLDNSTLMGDVVFSSNFDENFFPQGANSYRDADGDVD
TNGWDGTDRMDVTLNNGSKWVGAAMSVHMVDEDGDGSYDGYAVGTEATATLLDIAANSLWPSSTVGVDNINTQYDENGHI
VGNEVYQSGLFNVTLNGGSEWDTTKSSLIDTLSINSGSQVNVADSRLISDTVSLTGGSNLNIGEDGHVATNTLTIDNSTV
KMSDDVSAGWGLEDAALYANTITVTNDGLLDINVDQFDANPFQADTLNLTSTTDTNGNIHAGVFDIHSSDYVMDTDLVND
RTNDTTKSNYGYGLIAMNSDGHLTINGNGDNDNTASIEAGQNEVDNNGDHVAAATGNYKVRIDNATGAGSIADYNGNELI
YVNDKNSNATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSANTNIWNLEQDTVGTRLTNSRHGLADNG
GAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANN
VFVDGSLSYSHFNNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYXSISGLFQSGDDYQLSNDMKVDGQ
SYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSIDNGTEGSAVRVGLGTQFSFTKNFSAYTDANY
LGGGDVDQDWSANVGVKYTW