TCDB is operated by the Saier Lab Bioinformatics Group
>Q8XPT2|Q8XPT2_RALSO Secreted protein popf1 - Ralstonia solanacearum (Pseudomonas solanacearum).
MSTNISSAASPTLPLAGPGVNGPAEGKSDMPGSLFFQFDHSTGSTRPDLPTDLFFSFGDSISRAVQDASNQSPEQAPAAD
PAPASPDGQSCQPSQPATPPVGSDVTWNGGTLNDTQLQIIGILNLHKDKGDISWDKLQDKINDPDTPPDLKWALQALSQD
FNLFQAIGSQGDGRFGGKIKGKDLAEFAKSHSQVLTWNSGTLNDSQLEIMSILARHKDKMPVDWSSIQDKINDPSTPSDL
KAALQALANDPALFFAIGSQGDGNCKGKIKAGDVSKFADNHPQVEEYNRKKAEGYVKNYIPSDAKPGDKPSAMTQNDALR
ELYRYSDYLPKKLDMEAFQRIVDGDSDVKKAPPQVIAAAEYFLQNRNEWASLNKMDDPDKRVGKSDFLQRAASAVHLSKE
DLQTVSTINSNLDVFFKDGQKITRDRLAAMSQDESLSPAVRNAAKQLLQDPLLYGLINNANSGYKTKNGFFSFGGPTVDS
GVIGKKDFEKFMSSMTDANKTVQARKTHPANSEASKSAVADMGMGMEDQPDIKAVKKSGGALKKAMDKILTIYSKVMDIA
SQVVGALGVIPGLGEIADALSMGMAAGASAAKVLSTLLNGGSLKKALAEAGINLASAALGAVAGPEARVALKNGLTKMLV
EKVANTGIDLAVDKAKSFVDGYLQDLKGRLQATAANAANTVNTSVNWVSDKTKDFLENPVQNLTPRVNIPGITPYQPGYP
MVAAAA