TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8YMZ3|Q8YMZ3_NOSS1 ATP-binding protein of sugar ABC transporter OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) GN=alr4781 PE=3 SV=1
MAQVVLENVYKSFPPRRGENVSSQTPSAKKTDAEPAGTVNVLRRINLTIPDGEFMVLVGPSGCGKSTLLRLIAGLEVMTG
GNIWVGDRLVNDLPPKERDIAMVFQNYALYPHMTVYDNIAFGLRRRSGSEEHRDNHPSSPSQLPTWAENLLVGATRKLPK
GLRYISDQEREVDEQVRSVAHLLQIETLLHRLPKQLSGGQRQRVALGRAIARNPQVFLMDEPLSNLDAKLRAETRAQIVK
LQRQLGTTTIYVTHDQTEAMTMGDRIAIMNQGQIQQVASPLELYNHPANRFVAEFIGTPPMNFIPVEFHAPLLITHSQFR
LTLPEIWASVLQKYDKQTLILGIRPEHLTVSVPATKNLPVQVDLVENLGNDSFINVVLTEAESRFSHTIKPLQVRVPSDR
IINVSEQIWLSLTLDKIHFFDPDTDLAIFPKN