TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8YRV7|Q8YRV7_NOSS1 ABC nitrate transport permease protein OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nrtB PE=3 SV=1
MYSQARYKTFIQRIAIVSYQRLTQVFPSIFGICIFLISWHFLSLRPDTSLPSPVAVISNTWDLIKDPFFYKGGNNKGFFW
LILASLKRVVVGYLLATFIGIPIGFIISLNSFCRKAIDPLIQLLRPVAPLAWLPLAQAVFLKPNPSAIFVICITAIWPII
LNTALGVKLVPKDYRNVSKLLGLSPLENFYKILLPATLPYIFTGLRIAIGLSWLAVVAAEMLLSDDGIGFFIVDAYNNAN
IHEMILAIVYLGAVGLVLDKIMAYISEKVTPQE