TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8YU29|Q8YU29_NOSS1 Sugar ABC transport system, permease protein OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) GN=alr2532 PE=3 SV=1
MVLRIRRWRNNHRWNITDSLFGYVFMMPTLLVLGTFVVLPILYSVFLSLNKVQLLGGVAYQFIGLRNFQRLVDDELVWIA
LRNTAEYVVIVVPSQTVLALILAVTLNAGIRGKNWWRILYFLPTVTSSAVLTLIFMWIYNTDGLLNDFLAFLGLPTYNWL
GDPAVALKGIMLMNIWSTAPFYMVIYLAALQDIPAKLYEAAELDGANWWQQFIYITIPLLKPVTFFVIAVGVIGTFQLFD
QSYIFSGGTGGPNNATLTVVLLIYQMVFRYLQMGYAAAIAFLLAVVIIGITLIQRRVFAGE