TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8YVZ3|Q8YVZ3_NOSS1 Sugar ABC transportor, ATP-binding protein OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) GN=all1823 PE=3 SV=1
MAKVRLEDIKRRFNNVTAIEEISFEIPDGEFWVLVGPSGCGKSTILRTIAGLENATSGNLFIGDRLVNNIPARARDVAMV
FQNYALYPHMTVAENIAFGLKMRKINPKIVQERVVDVARSLSLDHLLDRKPKQLSGGQQQRVALGRAIAREPQVFLLDEP
LSNLDAQLRDDTRAELKQLHQQLGITTIYVTHDQVEAMTLADKIVVLSGGRIQQIGEPQGIYARPANQMVATFLGNPPMN
ILPATYQLAGFDINGQLLAIPAFLREKLQLRSAQRVNLGIRPEHISINSDAINDQSSGLLVDVKLVEPLGRETLVRVSLP
DSTVLLSVQLSGNVRLHPGDRLSLQLDLNQLFIFDPQTGYKISPQD