TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8Z042|Q8Z042_NOSS1 Sugar transport system permease protein OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) GN=all0261 PE=3 SV=1
MLRSLPLAKVLLYVLLTTYAVITLVPFLWALSASFKPLSEIVSGTPNFLPQNFTLDNYRQIFLQEPLFLRWLFNSVVIAV
SVTLLNLLFNSMAGYALARLSFVGKNFWFFLILAVLAVPAQITLIPTFLILKAIGWLNSYQGMIVPSMVNATFIFMMRQF
FINFPQELEEAAQLDGLNTIGIFRYIILPLAKPALAAQAVFVFMGSWNNFLLPVVILFEPEMFTLPLGLNTFKGQYISYW
NYIMAASMVFTLPALSIYAFFNRYFIQSATFTGGKG