TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8ZPK1|Q8ZPK1_SALTY ABC-type transport system protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=STM1494 PE=3 SV=1
MHTLTLKRVLGFTIVILLLLALFIWGIGLETLKARQVDLLYLGQRHLMLVFTSMFFALLVGIPSGILLSRPAAKGFAEYV
MQIFNVGNTLPPLAVLALAMVIIGIGDTPAIVALFLASLLPIVRNTYAGLCSVPASLIEAANGIGMTKWQRLRQVELPNA
WPVMLSGIRIATAINVGTAPLAFLIGASSYGELIFPGIYLNDFPTLILGATATALFALILDTLLAWFGRRLSPHTV