TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q92N44|Q92N44_RHIME Hypothetical transmembrane protein OS=Rhizobium meliloti (strain 1021) GN=R02386 PE=4 SV=1
MTGTDNRTILRLAFWGIPLSLGVMGLKMLAWWVTGSVALLSDGLESSVNVVAAVIAYAMIGYAAKPADADHPFGHHKAEY
FSAVIEGVLIVLAALLIIWEAIPEMMAPVLLNAPTLGLAINFAAGVVNAIWAYVLIRAGSRHRSPALSADGQHILSDVVT
SAGVLVGLLLAIATGYAILDPLLAVIVAGNILFQGWKVISRSVDGLMDKAVPADEEEAIKAAIAANAGGSLGVHDLKTRQ
AGPAIFVDFHMVVPEAMAVGDAHDICDRIEDAIRVVHPGAGIAIHVEPEGEKAHGVRVKVSGASRK