TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q93IU0|Q93IU0_STRCO BldKD, putative ABC transporter intracellular ATPase subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5115 PE=3 SV=1
MTTQTKPEEAPAAAAGDAFLSVRDLKVHFSTEGGVVKAVDGLSFDLERGKTLGIVGESGSGKSVTNLAVLGLHDRRRTAI
DGSITLDGQELTDASEKQLEKLRGKKMAMIFQDALTALSPYYTVGRQIAEPFMKHNGASKKDARVRAIDLLQKVGIPHPQ
KRVDDYPHQFSGGMRQRAMIAMALSCNPDLLIADEPTTALDVTVQAQILDLLKDLQQEFGSAIIMITHDLGVVGNMADDI
MVMYAGRAVERGTVREVLKSPQHPYTWGLLSSMPNLTSDVDEPLMPIPGSPPSLMNPPSGCAFHPRCGFTDLVSGERCSG
ERPTLPHGRAAACHLTGDQRQQVFIEKIQPRLG