TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q93IU1|Q93IU1_STRCO BldKC, putative ABC transport system integral membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5114 PE=3 SV=1
MLQFLIRRSFGAVLILVLISAFTFFMFFAIPQDPAMLACGKNCTPDALEIIHKNLGLDQPVTVQYWHFLAGIFTGRDFAV
GHCDAPCFGVSFANNQNVWDTILDRFPLTVSLTVGSLIVFLIVGLGAGLLAAKNRGTWIDKVFSSGSLVVSSLQIYFLGP
LVLLALVYSTGWLQKPKYVPISEDAAGWFAGLLIPWIVMATIFTANYTRMSRSSMIEQLQEEHVRAARAKGMSSNYTFFR
YAWRGSLVPIVTILGIDLSALMGGGMVTEMTFGLAGIGRLALESVINKDLPMLMGVMLVSAALIIVFNLIVDAMYAVIDP
RVRLS