TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q93IU3|Q93IU3_STRCO BldKA, putative ABC transport system integral membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5112 PE=3 SV=1
MTSPIEIEGAEASSVLDKESAPQGDAPKPKEPEGRKPGQLMWARFKRDRAGVISAFVVLFFFVIAAAAPLISMVYGKDPY
TLYGQDNPDLLDMFTMPAAPYGGIDGDFWFGIEPGLGRDVFTQLLYGMRNSMATALAATIIMTVLGVLIGLAGGYFGGKI
DYWLGRITDFFMALPSQLFFVAAMPVITTVFVAPDKETPTYVRAAAIIIVLSFLGWMSMARIVRGATMSLRDREFIEAAR
ISGASPWRILRKELLPNIVTPTLVQATLTLPSTILSIAFLSFVGVGYVEPTPDWGRMFAIGADIVEQDPYYMLFPGVAMV
IFIVAFNLLGDSVRDAFDPKGNR