TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q93TI8|Q93TI8_STRAG Capsular biosynthesis protein CpsH OS=Streptococcus agalactiae GN=cpsIVH PE=4 SV=1
MKINKNSLFYIAIFLVNFFKSLGLGEGNSTYKIVMFVAIFLCGIKFLLDSLYFERRKLVIIFLLFIATILNLFFVHKVTF
ILTLIFFLALKDISLKKAFSIIIGSRILGVLLNQIFVKLDLIEIKYINFYRDGQFILRSDLGFGHPNFIHNFFAVTVFLY
VTLFYRKLRLITIAFILTLNYFLYQYTYSRTGYYIVLLFILIIYVTKNNLIRKIFMIVAPYIQLFLLAFTFLCSTIFFNS
NFVQKLDSLLTGRLNYAHLQLVDGLTLFGNSFKETSVLFDNSYSMLLSMYGVVLTMFCMIIYYIYSKKVNVVELQILLFI
MSIVLFTESFYPSIVMNISWMVFGKIFCGGVDDLQREFTWTANKN