TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1
MEVTMEDRSVKADKADRDDNNTTSTELLGKMRQTKVISTNQNNNHLIDRMVSIYEMEMIKSQSTETISDVSDVLEFTVID
NCSHGTHTLEHDLRLKGEPIGKSESVKGVSRSLIIQIGMTVIFCALEFITGVVCSSIAMLADSYHMAADVMALIVAFTCI
KIATRPSTRLGYGWVRAETLGGFFNGIFMCTVCVLVFQEAVGRIINVHMITHPLQVLVIGFIGLLINLFGMFNLSGHGHS
HGGGSHGHSHGGSHGHSHNNKKTKKNDGHGHSHANGHGHSHDGKSDCNGEEEPDHTRLNGKFRSASAMANSDANVRLLDN
DDNSNDIIERRLSGVNSQNTIIATVDRQMTPYGTHMASEVLNVSSNNLDKSAQKTEQKKDKNVNIHGVWLHLLSDAFGSV
IVMISAGFVYFLPTWKIAAYLDPILSISLASIMGFTAVVLVKTSGEKLLKQTPEGLDLEKVKKDLCSIVGVSKVEKLSVW
TLCGQRIIAAAHVNICHPAVFPEAAYKIKNYFHDLGVHSTTIEPTFEDTCMQSMRIMVKKVVDGKSIEEPVSVSTENEIT
E