TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q96HV5|TM41A_HUMAN Transmembrane protein 41A OS=Homo sapiens OX=9606 GN=TMEM41A PE=1 SV=1
MRPLLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAYLYK
QGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATCCYLLSSIFGKQLVVSYFPDKVALLQRKVEENRNSLFFFLLFL
RLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTLTSLDALFSWDTVFKLLAIAMVALIPGTLIK
KFSQKHLQLNETSTANHIHSRKDT