TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q97RS3|Q97RS3_STRPN ABC transporter, ATP-binding protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0720 PE=3 SV=1
MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSSGSGKSSLFQMIAQVSSLPYSGQVLIDGSEVSQLSIVERVQTVGILLQ
NPNHQFTMESLFEELVFTMENIGYHLQEIDSKIAEVVQQCRCKDILHRLIHHLSGGEKQKAALAVLFAMNPRVYLLDEPF
ASIDRKSRIEILEILKELVYDGKTVILCDHDLSDYKAYIDHMVELRDGKLREVFQIPSYEMTQVASKEVASSPELFHMNR
VTGELGNRPLFSIADFTFYQGISCILGDNGVGKSTLFRSILQFQKYKGSITWKGSVLKKKKSLYRDLTGVVQEAEKQFIR
VSLREELQLDGPDSERNQRIFQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTSKASVILLDEPFAGLDDRACHYFCK
WIVEERNQGRSFLLISHRLDPLISVVDYWIEMTSQGLRHVKEVTITKPLTSQSSNTQGEVR