TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q99220|OS9_YEAST Protein OS-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOS9 PE=1 SV=1
MQAKIIYALSAISALIPLGSSLLAPIEDPIVSNKYLISYIDEDDWSDRILQNQSVMNSGYIVNMGDDLECFIQNASTQLN
DVLEDSNEHSNSEKTALLTKTLNQGVKTIFDKLNERCIFYQAGFWIYEYCPGIEFVQFHGRVNTKTGEIVNRDESLVYRL
GKPKANVEEREFELLYDDVGYYISEIIGSGDICDVTGAERMVEIQYVCGGSNSGPSTIQWVRETKICVYEAQVTIPELCN
LELLAKNEDQKNASPILCRMPAKSKIGSNSIDLITKYEPIFLGSGIYFLRPFNTDERDKLMVTDNAMSNWDEITETYYQK
FGNAINKMLSLRLVSLPNGHILQPGDSCVWLAEVVDMKDRFQTTLSLNILNSQRAEIFFNKTFTFNEDNGNFLSYKIGDH
GESTELGQITHSNKADINTAEIRSDEYLINTDNELFLRISKEIAEVKELLNEIVSPHEMEVIFENMRNQPNNDFELALMN
KLKSSLNDDNKVEQINNARMDDDESTSHTTRDIGEAGSQTTGNTESEVTNVAAGVFIEHDEL