TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q99445|GML_HUMAN Glycosyl-phosphatidylinositol-anchored molecule-like protein OS=Homo sapiens GN=GML PE=2 SV=1
MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISIRINSRELLVYKNCTNNCTFV
YAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP