TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q99WQ7|Q99WQ7_STAAM Putative uncharacterized protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0319 PE=4 SV=1
MNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHVHLAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTS
ITNLVITLFKVAGAMIGIMYVFKIGPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPI
FKTPGKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFSTVSATFMIIVAKTLGLMPHWNLYFWITLVITF
VVTAITAWLPPITNESTEYYNGQEGEQEVAIEGSRLKTAYAEAMKQNALTPSLVKNVWDNFKDGLEMTVGILPSILSIGF
LGLIVANYTPFIDWLGYIFYPFIYIFPIADQAVLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVPC
ILATEIKIPVWKLIIIWFLRVALSLLITIPVALLIFG