TCDB is operated by the Saier Lab Bioinformatics Group
>Q99WT8|ESAC_STAAM Protein esaC - Staphylococcus aureus (strain Mu50 / ATCC 700699).
MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSIALDDVESTAKDVQTAKSSANKDSVSVKGKA
PNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKGIAGEKASEYFNKAMN