TCDB is operated by the Saier Lab Bioinformatics Group
>Q99WU0|ESSB_STAAM Protein essB - Staphylococcus aureus (strain Mu50 / ATCC 700699).
MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHFHLMYLLEQHSPYFIDAELTELRDSFQIHYDINDNH
TPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDELFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVIC
AFNEKQSFDALVEGNLELHKGTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKVGHTVFKWVAIGMTTLSVL
LIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDLDGKKLDKEALYIYAKSYIQTNKQGLEKDKKENLLNNVTP
NSNKDYLLYWMELGQGHLDEAINIATYLDDNDITKLALINKLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKDE
KAKSEEEKAKAKDEKLKQQEENEKKQKEQAQKDKEKRQEAERKK