TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q99YA3|Q99YA3_STRP1 Ferrichrome transport system permease protein OS=Streptococcus pyogenes serotype M1 GN=M5005_Spy1527 PE=4 SV=1
MTASDLQRDQSLLAKKRFRSGLYLVLLILSLLFLAVIALSLGGLAVSYGAIVKGLFVAYDPQVALIYDLRFPRIVIALLA
GAGIAVSGVLFQAVLKNPISDPAIIGICSGASFMVLVSSLLLPQLLLYGPIVSFLGGGVSFLLIYGLAWKKGLNPIRLIL
TGIAINALFMGLSTALTSFFTSASPMVNALLAGHISQKTWADVGVLFPYTFIGLLLALLLSKTCNLLLLDDQVIRHLGID
ATALRLGISLVAVLLASVATSIVGVVSFLGLIVPHMSRLLVGSKHQILIPFSALLGAFVFLLADTLGRSLAYPLEISPAI
IMSIVGGPYFIYLLRRSDII