TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9AY27 IRON-PHYTOSIDEROPHORE TRANSPORTER PROTEIN YELLOW STRIPE 1 - Zea mays (Maize).
MDLARRGGAAGADDEGEIERHEPAPEDMESDPAAAREKELELERVQSWREQVTLRGVVAALLIGFMYSVIVMKIALTTGL
VPTLNVSAALMAFLALRGWTRVLERLGVAHRPFTRQENCVIETCAVACYTIAFGGGFGSTLLGLDKKTYELAGASPANVP
GSYKDPGFGWMAGFVAAISFAGLLSLIPLRKVLVIDYKLTYPSGTATAVLINGFHTKQGDKNARMQVRGFLKYFGLSFVW
SFFQWFYTGGEVCGFVQFPTFGLKAWKQTFFFDFSLTYVGAGMICSHLVNISTLLGAILSWGILWPLISKQKGEWYPANI
PESSMKSLYGYKAFLCIALIMGDGTYHFFKVFGVTVKSLHQRLSRKRATNRVANGGDEMAALDDLQRDEIFSDGSFPAWA
AYAGYAALTVVSAVIIPHMFRQVKWYYVIVAYVLAPLLGFANSYGTGLTDINMAYNYGKIALFIFAAWAGRDNGVIAGLA
GGTLVKQLVMASADLMHDFKTGHLTMTSPRSLLVAQFIGTAMGCVVAPLTFLLFYNAFDIGNPTGYWKAPYGLIYRNMAI
LGVEGFSVLPRHCLALSAGFFAFAFVFSVARDVLPRKYARFVPLPMAMAVPFLVGGSFAIDMCVGSLAVFVWEKVNRKEA
VFMVPAVASGLICGDGIWTFPSSILALAKIKPPICMKFTPGS