TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9BVT8|TMUB1_HUMAN Transmembrane and ubiquitin-like domain-containing protein 1 OS=Homo sapiens GN=TMUB1 PE=1 SV=1
MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQA
AQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLH
LPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLA
FAMYRP