TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9CIK8|Q9CIK8_LACLA Oligopeptide ABC trasporter ATP binding protein OS=Lactococcus lactis subsp. lactis GN=optF PE=4 SV=1
MMTEPKKVIEIKNLDLTFNKGKKGANKAINNVSLDIYEGETFGLVGESGSGKTTIGRAILKLYDNFITGGEILFEGKDVR
NLKGSELREYRSEAQMIFQDPQASLNGRMRVKDIVAEGLDANGLVKTKAERDARVLELLRLVGLNDDHLTRYPHEFSGGQ
RQRIGIARALAVKPKFVVADEPISALDVSIQAQVVNLMRDIQAKENLTYLFIAHDLSMVKYISDRIGVMHWGKILEVGTS
DQVYNHPIHPYTKSLLSSIPSPDPISERERTPIVYDPTAELDGQEREMREITPGHFVFSTEAEAEIYKKNATV