TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9CIL1|Q9CIL1_LACLA Oligopeptide ABC trasporter permease protein OS=Lactococcus lactis subsp. lactis GN=optB PE=3 SV=1
MIKYILKRLGLLLLTLFLIVTLTFFMMQVMPGTPFSNPKLTPDQLEILKHAYGLDKPLWQQYFIYVGHMFTGNFGTSFVY
TNQPVITMIAQRLPVSMQLGVQALILGTILGAFMGKASARRKNGILDGIFGFVSVLGISVPSFVIGTLILLYLGFNLNLF
PISGWGTFSQTIMPTIALSFAPMAVVTRFVRSEMIESLSSDYILLARAKGLSEKEVVNKHALRNSLIPMLTLIGPMAANL
LTGSVLIEKIFSIPGIGSQFVDSIPAKDFPVIMATTIVYAVILMLFILVTDILTAIVDPRVRL