TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9CIL2|Q9CIL2_LACLA Oligopeptide ABC transporter substrate binding protein OS=Lactococcus lactis subsp. lactis GN=optA PE=4 SV=1
MKTWKKVTLGTVALGSAALLAACGNSGSSSSSSSKDIQWNLTSPIQTLDSSLATDTYSNIIIGNTNAGLTRVDKDGKAQP
ELAKSVDVSKDGLTYTFHLRDGLKWSNGDALTAKDFVYSWQRAVDPATASEYGYLLGPVKNANEINGGKADKSTLGVKAT
DDKTFVVTLAQPTPYFEFLTANSVYYPLNQKVVEKYGKQYGTSSEKMVYSGPYKFEKSKGWNGSNQTFSIVKNDDYWDKS
AVKTKEIDFQVVQDPKTSFNLYKQGKIVQASIGDPDLFKANKNNKDVVSLDEATTAYIQYNQSGKNKALANKNIREAFNL
ATDRQQYVDTVTPASNPATGLTPAGMAKTNTGVDFAKYAAQPYKYDATAAKAAWAKGLSEIGETKLTLTLTTDDTSASKD
SATFLKQAWEKQLPGLTLNIKSVPFKQRLNDSTTGNFDMVISLWGGDYAEPSTFLDLFVKDGPNNNGKINNVTYDKAIKA
AEVTDALDPEKHYADYKAAEESLYTESNLNPLYFRTTPVLRNPNLKDVRFGSTGLMYDFKTAYLK