TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9CLG8|Q9CLG8_PASMU Putative uncharacterized protein OS=Pasteurella multocida GN=PM1266 PE=4 SV=1
MSAVEIRDLRLSYNQQPLFAGFNFVLPKGKWTTLLGASGIGKSTLVRAIAGLENHAITEGEIVLSPTQQISYMAQQDALY
PWLSVLDNVQLHLHLQGKKNKQSEEKAKALLTAVKMASHWHKPCYQLSGGQRQRVALARTLMQDANTILMDEPFSALDAV
TRIQLQDLACDLLKHKTVLLITHDPQEAIRLSDTIYVLKNQPARLSEPIELSSAPPRQLGQQDLWLLQEQLLAQLIEGQH
EN