TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9EP96|S215_MOUSE Solute carrier family 21 member 5 (Sodium-independent organic anion transporting polypeptide 2) - Mus musculus (Mouse).
MGKSEKEVATHGVRCFSKIKAFLLALTCAYVSKSLSGTYMNSMLTQIERQFGIPTSVVGLINGSFEIGNLLLIIFVSYFG
TKLHRPIMIGVGCAVMGLGCFLISIPHFLMGRYEYETTILPTSNLSSNSFVCTENRTQTLKPTQDPTECVKEMKSLMWIY
VLVGNIIRGMGETPIMPLGISYIEDFAKSENSPLYIGILETGMTIGPLIGLLLGSSCANIYVDTGSVNTDDLTITPTDTR
WVGAWWIGFLVCAGVNILTSIPFFFFPKTLLKEGLQDNGDGTENAKEEKHREKIKEENRGITKDFFLFMKSLSCNPIYMI
FILISVIQVNAFINSFTFMPKYLEQQYGKSTAEIVFLMGLYMLPPICLGYLIGGLIMKKFKITVKKAAYIGFWLSLTEYL
LSFVSYIMTCDNFPVAGLTTSYEGVQHPLYVENNVLADCNTKCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGTGTNMV
FQNCSCIQSSGNASAVLGLCDKGPECANKLQYFLIISIIGCFIFSLGAIPGYMVLLRCMKSEEKSLGVGLHTFCMRILGG
IPAPIYFGALIDRTCLHWGTLKCGEPGACRMYDINSFRRIYLGLPAALRGASFLPALFILILMRKFQFPGDIDSSDTDPA
EMKLTAKESKCTNVHRSPTMQNDGERKTKL