TCDB is operated by the Saier Lab Bioinformatics Group
>Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 - Rattus norvegicus (Rat).
MDPIELRSVNIEPYEDSCSVDSIQSCYTGMGNSEKGAMDSQFANEDAESQKFLTNGFLGKKTLTDYADEHHPGTTSFGMS
SFNLSNAIMGSGILGLSYAMANTGIVLFVIMLLTVAILSLYSVHLLLKTAKEGGSLIYEKLGEKAFGWPGKIGAFISITM
QNIGAMSSYLFIIKYELPEVIRVFMGLEENTGEWYLNGNYLVLFVSVGIILPLSLLKNLGYLGYTSGFSLTCMVFFVSVV
IYKKFQIPCPLPVLDHNNGNLTFNNTLPMHVIMLPNNSESTGMNFMVDYTHRDPEGLDEKPAAGPLHGSGVEYEAHSGDK
CQPKYFVFNSRTAYAIPILAFAFVCHPEVLPIYSELKDRSRRKMQTVSNISITGMLVMYLLAALFGYLSFYGEVEDELLH
AYSKVYTFDTALLMVRLAVLVAVTLTVPIVLFPIRTSVITLLFPRRPFSWVKHFGIAAIIIALNNVLVILVPTIKYIFGF
IGASSATMLIFILPAAFYLKLVKKEPLRSPQKIGALVFLVTGIIFMMGSMALIIIDWIYNPPNPDHH