TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9EY29 Putative inner membrane protein - Xanthomonas oryzae pv. oryzae.
MPRLRPACVRPLQQDTHTMALELNANRRIGLALLWLALLAVAGFWLSETLKVTGDLRKFMPAPRTPAQKLLIEELGEGPG
SRLLLMALSNSDPVTLAEQSQQLQKALAAQPELFELVGNGGNAGLEAIPKRLLPYRYLLSDSFDKTPLDAPTLEAALQAR
VQDLGSPAAAMVEPLLPRDPTMEILHLAETLQPAAMPQTRNDVWFDRAGTSALLIVQTRAAGFDPTGQQLAYDAVQAAFA
KVSKGTSTRLTLTGPGAFAVEITARTQGEAQWIGTLDTVGLVLLLLVAYRSWKIPVLGVLPLASAGLAGLGAVAVLFDGV
HGITVAFGFTLIGVVQDYPIHLFSHQRPGLDPRENARHLWPTLVTGVVSTCIAYVTFLFSGVDGLRQLAVFTIAGLATAA
VTTRWMLPALIDPAPRDYADSRLLAVLWRGVARLPRPRIVSLAVMAVLSIAVIVLAPGQFWQNDLSKLTPVPPKALAQDM
HLRQELGAPDVRYVLALPAANDEAALQASEQLRPRLDALVRNGDLLGYDMAARYLPSAKTQHARQAALPDAAQARAFTET
AVATTPFRSDAFAPFLQDLDAAKRAAPLLPKDLTGSPLATSVGGLLLGRGDRSTALVSLTGLRDPAVLAAAVQGSGAQLL
DLKDASESLVAAYRGRVLGALVLAALLLAVTVAIALRSPRRIVRVLLPMALTTVLILAILRGTGVELNLFHLIALILAAG
LGLDYALFFDHAGDDHADQLRTLHALIVCSLMTLLVFALLAASSIPVLRAIGSTVALGVLFNFILALLVSREPALERTAN
GEPHAGT