TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9FBS5|Q9FBS5_STRCO Putative secreted sugar-binding protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO7167 PE=4 SV=1
MARRRSINAAVGILLGLALTTACGGSGGFEADSAADPDSGATGTVRMLVNITPNLTKGYWRELVAPFEKANPGIKVQIDS
PTAADGSVDSTLQQLLAAGNAPDVVEGSHNDKVLPYLRDLSDLGWAADAPMADAQRLDGHLYDVAIGQQVQSLVFYNKKA
FEKAGITKPPATMRELTTAMRKLKSAGYLPMQTAGEWVTQAQVMMLFAPTVTTGEPDWFKQASDGRRSLGTDLGPAMDLY
KDWLDEGYLDKQALGTKYADAETEFLSGKAAMYPMGCWFVAAEAQAKKDFEVGVFASPQLNDASTPRLSVTPGANYRIFK
AGEHQKASEKLVQFLTTDRAAVAGQLKQDSSFRTGYPYKLSPLADEVQALLDKSPNHQAIAGSGEYQMPTGFEAEQNKQV
QSLYTGGDAADGLKNVDTWLKAHTK