TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9FGS9 FRO1 and FRO2-like protein - Arabidopsis thaliana (Mouse-ear cress).
MAKVLTLLVLRLLMNLLLIGWISLWIIKPTTIWIQSWRQAEDTARHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQH
HHPTRGGRGAAITVSRPAIINSFIGIVSCFEILALLLFLLFLAWNFYARVSNDFKKLMPVKTMNLNLWQLKYYRVATRFG
LLAEACLSLLLFPVLRGLSMFRLLNIEFAASVKYHVWFGTGLIFFSLVHGGSTLFIWTITHHIEEEIWKWQRTGRVYVAG
LISLVTGLLMWITSLPQIRRKNFEVFYYTHHLYIVFLVAFLFHAGDRHFYWVLPGMFLFGLDKILRIVQSRSESCILSAN
LFSCKAIELVLPKDPMLNYAPSSFIFLNIPLVSRFQWHPFSIISSSSVDKHSLSIMMKCEGDWTNSVYNKIEEAANCENK
INNIIVRVEGPYGPASVDFLRYDNLFLVAGGIGITPFLSILKELASKNRLKSPKRVQLVFAVRTFQDLNMLLPIASIIFN
PIYNLNLKLKVFVTQEKKPSNGTTTLQEFLAQSQVQSIHLGTDEDYSRFPIRGPESFRWLATLVLITVLTFLGFLIGVMK
LAASGAMKTAKEKVPSWVPDLIIIVSYVIAISVGGFAATILQRRRKHKEAPRMSKEVVIKPEERNFTELKPIPITEEHEI
HIGERPKLEEIMSEFEKNLRGWSSVGVLVCGPESVKEAVASMCRQWPQCFGVEDLRRSRMKMNLNFHSLNFNL