TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HJ13|Q9HJ13_THEAC Cationic amino acid transporter related protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1161 PE=4 SV=1
MHGIFQSMGQVAPAADIAILLVATFSIAGSRTILSVIFGWLVYAIFMVTPYQFSKYKSNAGSYYAFAAGSTESGKLGPVT
ALSFMYYDITGAAFGILGLSSFIFLISPRITAIPYIWILFAGAFTAYITIVTYIGIKPSLGYNAVAGLAEVLFLVIGAVI
IILGVGPHNSIVPFTLPSNLGVGFSAIMFGAVFSILDFTGTGIVTTVSEEIKDPKRNIGRSILYAMILTAIAIIPATYAL
TVGWGVSNIGSFASAPDAGIIVFGKYLGPIGVILLIIFTVNSYLTNGVSKATAVGRWWYSAASDNVIFPKSIARIHPKYR
SPYMAIIVWSLTSFVLDVLMGLYFGPKIAAFILEAGTGISIIIVHIMANTSLTYYTRRIEKFQFLKHALAPAVATVIGLI
VIYFTVSNIWTKWITDPDPVNDAYFASFIITILWVVVGGFIVTLYYSRKKPEVLKSAGEFDVENLKV