TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HV90|Q9HV90_PSEAE Heme-transport protein, PhuT OS=Pseudomonas aeruginosa GN=phuT PE=4 SV=1
MRIDRLFNGLALGILLGTGMAQAAELPQRWVSAGGSLSEWVVALGGESKLVGVDTTSQHPQALKQLPSVGYQRQLAAEGV
LALRPDILIGTEEMGPPPVLKQLEGAGVRVETLSAKPDLEALESNLKKLGDWLGVPQRAEAAELDYRQRLRRQADWIAAA
QKSQPAPGVLLVIGNAGGQLLVAGRNTGGDWVLNRAGARNLATHEGYKPISVEALAALDPVAVVIADRSLEGDAARAALL
KQNPGLAATRAARDGRLLVLDPTLLVGGLGPRLPDGLAALSAAFYPSAKPLSTEAAH