TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9HZ04|Q9HZ04_PSEAE Probable glycine betaine-binding protein OS=Pseudomonas aeruginosa GN=PA3236 PE=4 SV=1
MRMMRRLLCWSAGLAMSAAVGMAAAADKPVITIGYVDGWSDSVATTHVAAEVIREKLGYEVKLMPVAAGIMWQGVARGKL
DAMLSAWLPGTHGAYYEKMKDKVVNLAINYPDARIGLIVPEYVSANSIADLQAQKDAFGGRVVGIDAGAGVMIKTDEAIK
QYGLDYKLVASSGSGMIAELTRAENEKKPVVVTGWIPHWMFAKWKLKFLDDPKKVYGDTEHVDTVANPALEAKAKPVWEF
LKKFGWKDGNEVGQVMLAIQEGAKPEDAAKQWVAANPGRVKDWVQ